PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_008638
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family WRKY
Protein Properties Length: 202aa    MW: 23530.1 Da    PI: 5.6018
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_008638genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.55.6e-33122180159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+vk+s fprsYYrCt+++C+vkk+v+r ++d+++v++tYeg Hnh+
  DCAR_008638 122 LDDGYRWRKYGQKSVKNSLFPRSYYRCTHHTCNVKKQVQRLSRDTSIVVTTYEGIHNHP 180
                  59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.4E-33109180IPR003657WRKY domain
SuperFamilySSF1182901.31E-28115181IPR003657WRKY domain
PROSITE profilePS5081128.839117182IPR003657WRKY domain
SMARTSM007749.8E-39122181IPR003657WRKY domain
PfamPF031062.5E-26123180IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MEKQEMTPAA AAHPTNYVFT PQTPQMPSDM DWSFFLSHPD PEQVPSQYEM PSASVTTTLV  60
SEDQTKISNC DDHDHLKEEE DEEEEEEEQD RNKEKRRASR VSRRKAGPPR VEFQTKSSED  120
LLDDGYRWRK YGQKSVKNSL FPRSYYRCTH HTCNVKKQVQ RLSRDTSIVV TTYEGIHNHP  180
CEQIMETLSP LLKQMQFLAQ F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-25113179874Probable WRKY transcription factor 4
2lex_A6e-25113179874Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00317DAPTransfer from AT2G46130Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006444939.11e-65hypothetical protein CICLE_v10024257mg
RefseqXP_006491470.11e-65PREDICTED: probable WRKY transcription factor 43
TrEMBLV4VXQ81e-65V4VXQ8_9R
STRINGVIT_15s0046g02150.t015e-60(Vitis vinifera)
STRINGPOPTR_0002s16640.11e-60(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA63742433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46130.16e-55WRKY DNA-binding protein 43